DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Send1

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:251 Identity:69/251 - (27%)
Similarity:117/251 - (46%) Gaps:29/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IEP--KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKY 93
            :||  :|:||....|..|.:|||::.       ||. |.|||.:.|:.::.|||||.        
  Fly    24 LEPSERIIGGSSMDITDVPWQVSLQY-------YGE-HFCGGSIYSKTIIITAAHCI-------- 72

  Fly    94 RTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALA 158
             ..||..:..||:...|.   .::..::..|.|..::...:.||:|::.::..:.:: .::..:.
  Fly    73 -KEGERSIRAGSSLHDSG---GVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFS-DSIQTIP 132

  Fly   159 LNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISY-NSIPVSQVCAGYLSGG 222
            |......|::..|.:|||  :.|.......||...:.|.....|::.| |.:....:|||.:..|
  Fly   133 LAETDPPTSSSALATGWG--RGNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAGRMGKG 195

  Fly   223 VDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNSSLNY 278
              .|.||||||:..||.|.||.|........| ..:|.:|:.|.:||:.....|::
  Fly   196 --GCYGDSGGPLVFNGQLVGITSRTGNIVCLG-SSLYASVARYRNWILSAIDVLHF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 64/235 (27%)
Tryp_SPc 35..272 CDD:238113 66/237 (28%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 64/235 (27%)
Tryp_SPc 30..239 CDD:238113 64/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.