DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG11911

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:296 Identity:89/296 - (30%)
Similarity:124/296 - (41%) Gaps:45/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWAILAIALFLGALASGESLSSETAGKIEPK-----IVGGYDASIEQVSYQVSIRLTANDKK 60
            |..:...|.|||.  |.|.|..||.:.| |:.|.     ::.|.:|......|.||  |..|..|
  Fly     1 MKLITVTLVIALV--AAAQGAKLSDKLA-KLVPSFATGFVINGTEAEPHSAPYIVS--LATNYLK 60

  Fly    61 SYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQL-- 123
               ..|:|||.:|::..:.|||||  |::.            :|.:.:.....|..:..|.|.  
  Fly    61 ---HSHICGGTLINKDWIVTAAHC--ISEP------------VGMSIIAGLHTRAEVDELTQQRQ 108

  Fly   124 ----ITHENYNPDALTNDIALMFINGYIPWN-WPTVTALALNSQLVATNTDCLISGWGLLQQNGT 183
                ..||.|.......||||:.:|....:| |.....|....|:....|.  :.|||..:....
  Fly   109 VDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETH--LYGWGQPKSYIF 171

  Fly   184 FSSNTLQAATVPIVSYTTCRISY-NSIPV--SQVCAGYLSGGVDACQGDSGGPM-----SCNGML 240
            ..:.|||..|..|::|..|:... .|.|:  |.:|:..|.....||.||||||:     :....|
  Fly   172 SGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSEL 236

  Fly   241 AGIVSYG-AGCAAPGYPGVYTNVSYYYDWIVQKNSS 275
            .||||:| ..|.....|.:||.||.|.|||....|:
  Fly   237 IGIVSWGYIPCGLANMPSIYTKVSAYIDWITNIQSA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 73/255 (29%)
Tryp_SPc 35..272 CDD:238113 75/252 (30%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 75/252 (30%)
Tryp_SPc 37..266 CDD:214473 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.