DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG9673

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:288 Identity:78/288 - (27%)
Similarity:126/288 - (43%) Gaps:65/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVIS 74
            |.|.||.|..|..||:|.:.  :.:|:||.|.:..:..:..|:|        |...|:|.|.:||
  Fly     6 ITLGLGLLIFGLILSAEASP--QGRILGGEDVAQGEYPWSASVR--------YNKAHVCSGAIIS 60

  Fly    75 QRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDR----TLMYY-------LQQLITHEN 128
            ...:.|||||               |..:|.|.:.:||..    |:..|       ::.:|.|.:
  Fly    61 TNHILTAAHC---------------VSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPS 110

  Fly   129 YNPDALTNDIALMFINGYIPWNWPTVTALAL-----------NSQLVATNTDCLISGWGLLQQNG 182
            |.  ...:|||::.::..:.:: ..:..:||           :::| ...|...::|||.| .:|
  Fly   111 YG--NFLHDIAILELDETLVFS-DRIQDIALPPTTDEETEDVDAEL-PNGTPVYVAGWGEL-SDG 170

  Fly   183 TFSSNTLQAATVPIVSYTTCR----ISYNSIPVSQVCAGYLSG-GVDACQGDSGGP-MSCNGMLA 241
            | :|...|.|....:|.:.|.    ..|.|:    ||.....| |:  |:||:|.. :..:.:|.
  Fly   171 T-ASYKQQKANYNTLSRSLCEWEAGYGYESV----VCLSRAEGEGI--CRGDAGAAVIDDDKVLR 228

  Fly   242 GIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
            |:.|:..|.....||.|.|.||||..||
  Fly   229 GLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 67/262 (26%)
Tryp_SPc 35..272 CDD:238113 69/263 (26%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 67/262 (26%)
Tryp_SPc 29..259 CDD:238113 69/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.