DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG9676

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:277 Identity:85/277 - (30%)
Similarity:128/277 - (46%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG 65
            |...|..|.:....|.||..:|:       :||:||||..|...|..:|:|:|...:        
  Fly     1 MLPFWTSLLVLCAAGVLAQNDSV-------VEPRIVGGTKAREGQFPHQISLRRRGS-------- 50

  Fly    66 HLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYN 130
            |.|||.:||:..|.|||||  :........|.|..:..||..|:|...|.   .:..:..|.|||
  Fly    51 HTCGGSIISKDYVVTAAHC--VKQGNNVAPANELEIQAGSLLLSSGGVRV---PVATVTVHPNYN 110

  Fly   131 PDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVP 195
            .:.  :|:|::.:...:.:| ..:.|:.|.::....:....|||||.:.|.|.. ||:|....|.
  Fly   111 SNG--HDVAVLRLRNSLTFN-SNIAAIKLATEDPPNDATVDISGWGAISQRGPI-SNSLLYVQVK 171

  Fly   196 IVSYTTCRISY-NSIPVSQVCAGYLSGGVD--ACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPG 257
            .:|..:|:.:| ..:|.:.:|   |....|  ||.||||||.:..|.|.|:.|:..|......|.
  Fly   172 ALSRESCQKTYLRQLPETTMC---LLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPD 233

  Fly   258 VYTNVSYYYDWIVQKNS 274
            .|..||...:||.:|.|
  Fly   234 GYERVSKLRNWIAEKAS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 72/237 (30%)
Tryp_SPc 35..272 CDD:238113 74/239 (31%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 72/237 (30%)
Tryp_SPc 28..248 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.