DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG32834

DIOPT Version :10

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:303 Identity:80/303 - (26%)
Similarity:125/303 - (41%) Gaps:69/303 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VWAILAIALFLGALASGESLSSETAGKI--EPKIVGGYDASIEQVSYQVSIRL--TANDKKSYGS 64
            :|::     ||..||   :|.....|.:  :.:|:||||..||...||..:.:  ||        
  Fly     2 IWSV-----FLFLLA---ALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTA-------- 50

  Fly    65 GHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTD---RTLMYYLQQLITH 126
              :|.|.:|:...:.|||.|        .::.|...:.:|    |||.|   ...:..:.::|.|
  Fly    51 --ICSGAIITSDTIITAASC--------VQSYGSIEVRVG----TSSRDYDGTGFLLEVCEIINH 101

  Fly   127 ENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTD-----CLISGWGLLQQNGT--- 183
            ..||.....|::||:.:..      |..|:.|:....:|.:..     |.:||||.....|:   
  Fly   102 PQYNCWRFDNNLALLKLCD------PLKTSEAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWD 160

  Fly   184 --FSS--NTLQAATVPIVSYTTCRISY--------NSIPVSQVCAGYLSGGVDACQGDSGGPMSC 236
              |.|  :.||.|.|.:.:...|....        |.|....:|....:||   |..|:|.|:..
  Fly   161 RCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLWDNGISYLTLCTHNGAGG---CSYDTGAPLVI 222

  Fly   237 NGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNSSLNYT 279
            :|.|.||:|.| ||...  |.||.||.::..||.:.....:.|
  Fly   223 DGQLVGILSEG-GCTTK--PDVYANVPWFTGWIAENTEDEDTT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 70/259 (27%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 70/259 (27%)
DUF5585 284..>552 CDD:465521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.