DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG32808

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:286 Identity:87/286 - (30%)
Similarity:127/286 - (44%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGG 70
            |:...|.||.|.||||          :.|||.|..|...:..:.||:|      ::....|.||.
  Fly    11 ALFYTATFLLAGASGE----------DGKIVNGTTAGPGEFPFVVSLR------RAKSGRHSCGA 59

  Fly    71 VVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNP-DAL 134
            .:::...|.|||||.      :..:..:..|..||..|..::.:...  :..:..|..|.| |..
  Fly    60 TLLNPYWVLTAAHCV------RGSSPEQLDLQYGSQMLARNSSQVAR--VAAIFVHPGYEPEDKY 116

  Fly   135 TNDIALMFINGYIPWNWPTVTALALNS-----------QLVATNTDCLISGWGLLQQNGTFSSNT 188
            .|||||:.:          ..::||:.           |:...|...:::||||....|....: 
  Fly   117 VNDIALLQL----------AQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQH- 170

  Fly   189 LQAATVPIVSYTTCRISYNS-IPVSQVCAGYLSGGVDACQGDSGGPMSCNG--MLAGIVSYG-AG 249
            ||...:.:.|.|.|...:.: :..||:|||...||...|.||||||:...|  ...||||:. ..
  Fly   171 LQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKP 235

  Fly   250 CAAPGYPGVYTNVSYYYDWIVQKNSS 275
            ||.|.:|||:|.||.|.||||:..:|
  Fly   236 CARPPFPGVFTEVSAYVDWIVETVNS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 74/250 (30%)
Tryp_SPc 35..272 CDD:238113 76/252 (30%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/250 (30%)
Tryp_SPc 30..258 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.