DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and LOC312273

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:271 Identity:88/271 - (32%)
Similarity:133/271 - (49%) Gaps:37/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVV 72
            :.|.:|...|.:..:..:|..   :.:|||||......|.||||:.         ...|:|||.:
  Rat     1 MKICIFFTLLGTVAAFPTEDN---DDRIVGGYTCQEHSVPYQVSLN---------AGSHICGGSL 53

  Fly    73 ISQRLVATAAHCCY------ITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNP 131
            |:.:.|.:||||.:      :.:...|...|      ...::.::          ::|.|.:|:.
  Rat    54 ITDQWVLSAAHCYHPQLQVRLGEHNIYEIEG------AEQFIDAA----------KMILHPDYDK 102

  Fly   132 DALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPI 196
            ..:.|||.|:.:......| ..|:.:.|........|:||:||||:| :.|..|.:.||....|:
  Rat   103 WTVDNDIMLIKLKSPATLN-SKVSTIPLPQYCPTAGTECLVSGWGVL-KFGFESPSVLQCLDAPV 165

  Fly   197 VSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYT 260
            :|.:.|..:| ..|..:..|.|:|.||.|:||.|||||:.|||.:.||||:|.|||..|.|||||
  Rat   166 LSDSVCHKAYPRQITNNMFCLGFLEGGKDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYT 230

  Fly   261 NVSYYYDWIVQ 271
            .|..|.:||.|
  Rat   231 KVCNYLNWIHQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 81/241 (34%)
Tryp_SPc 35..272 CDD:238113 84/244 (34%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.