DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG3795

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:294 Identity:90/294 - (30%)
Similarity:142/294 - (48%) Gaps:24/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GALASGESLSSETAGKIEPKIVGGY--DASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRL 77
            |.|.|..|...:.....:..:.|||  |.: :.|.|.||:|: ...||.:|..|.|.|.:.|:|.
  Fly    26 GQLHSAPSQRQDRPSDFQFLVTGGYRPDTN-DLVKYTVSLRM-GKPKKFFGDNHFCAGTIFSERA 88

  Fly    78 VATAAHCCYITDKKKYRTAGEFVLVMGS--TYLTSSTDRTLMYYLQQLITHENYNP-DALTNDIA 139
            :.|||||.: ::::|.: |.:.::|.|:  ..|.|||  |.:...::|:.|..|.. .:...||.
  Fly    89 ILTAAHCMF-SNRRKLK-AKKLMVVAGTPRRLLKSST--TQIIEAEELLPHPKYKKGKSQKYDIG 149

  Fly   140 LMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRI 204
            |:.:...:... ..|..:.|.:::......|.|.|||.:.|.|......:. ..:.|:..|.|..
  Fly   150 LILLEADLSLG-DAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAIN-GDMQILPDTFCEK 212

  Fly   205 SYNSIPVSQVCAG-YLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDW 268
            .........:||. .....||:||||||||:.|:.|:.||||:|.||..|...|:||:|.::.||
  Fly   213 LLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDW 277

  Fly   269 IVQKNSSLNYTIYHNGGVRQGSSWSYLGILPLLV 302
            |.:.:..|        |.|  |.|:...:|.||:
  Fly   278 ITENSCPL--------GTR--SVWTLFLLLLLLL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 76/240 (32%)
Tryp_SPc 35..272 CDD:238113 78/242 (32%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 73/227 (32%)
Tryp_SPc 60..278 CDD:214473 71/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.