DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and CG14780

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:306 Identity:106/306 - (34%)
Similarity:167/306 - (54%) Gaps:33/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCG 69
            |.:||.|            :::.....:.:|:.|..|..::..:.|||||..:| .::||||:||
  Fly    15 WFLLACA------------AADLQENQQSRIINGSVAKADETRHLVSIRLLRHD-NNFGSGHICG 66

  Fly    70 GVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDAL 134
            |.:|:.|.|.|||||.|...:|::|.|.|||:|:|:.......:.|::..:..:.....::||::
  Fly    67 GALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSM 131

  Fly   135 TNDIALMFINGYIPWNWP------TVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAAT 193
            .:|:.::|:...:|.: |      ||..:.|..|:......|.::|||..:|:..  ||.|..|.
  Fly   132 RDDVGILFLRTGLPMS-PGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSL--SNILLTAN 193

  Fly   194 VPIVSYTTCRISYNS--IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYP 256
            |..:.:.|||:.|.|  :| ..:|||.|.||.|:||||||||:...|.|.|:||:|.|||.||.|
  Fly   194 VSTIRHQTCRMIYRSGLLP-GMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLP 257

  Fly   257 GVYTNVSYYYDWIVQKNSSLNYTIYHNGGVRQGSSWSYLGILPLLV 302
            |||.:|.||..||..::.:     .|:   |..:....|.:||||:
  Fly   258 GVYVDVEYYRQWIEGRSGA-----PHS---RLATGLFLLLLLPLLM 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 93/242 (38%)
Tryp_SPc 35..272 CDD:238113 95/244 (39%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 93/242 (38%)
Tryp_SPc 33..271 CDD:238113 94/242 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0012686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.