DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Klk12

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:248 Identity:86/248 - (34%)
Similarity:120/248 - (48%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGE 98
            ||..|.:.......:||.:        .:|....||||::.::.|.|||||           :|:
  Rat    21 KIYNGVECVKNSQPWQVGL--------FHGKYLRCGGVLVDRKWVLTAAHC-----------SGK 66

  Fly    99 FVLVMGSTYLTSSTDRTLMYYLQQL------ITHENYNPDALTN---DIALMFINGYIPWNWPTV 154
            :::.:|...| |..|.|     :||      |||.:|: .|..|   |:.|:.:|..|...: .|
  Rat    67 YMVRLGEHSL-SKLDLT-----EQLRLTTFSITHPSYH-GAYQNHEHDLRLLRLNRPISLTY-AV 123

  Fly   155 TALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISY-NSIPVSQVCAGY 218
            ..:||.|....|...|.|||||...:......:.||...:.|||..|||..: ..:..:.:|||.
  Rat   124 RPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRAVFPGRVTENMLCAGG 188

  Fly   219 LSGGVDACQGDSGGPMSCNGMLAGIVSYGA--GCAAPGYPGVYTNVSYYYDWI 269
             ..|.||||||||||:.|.|:|.|:||:|:  .|...|.|||||.|..|.|||
  Rat   189 -EAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 84/246 (34%)
Tryp_SPc 35..272 CDD:238113 85/247 (34%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.