DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and F12

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001014028.1 Gene:F12 / 306761 RGDID:1359175 Length:603 Species:Rattus norvegicus


Alignment Length:256 Identity:80/256 - (31%)
Similarity:119/256 - (46%) Gaps:39/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGE 98
            ::|||..|......|..::         |.....|.|.:|....|.|||||.     :|.....|
  Rat   361 RVVGGLVALPGSHPYIAAL---------YWGDSFCAGSLIDPCWVLTAAHCL-----QKRPAPEE 411

  Fly    99 FVLVMGSTYLTSSTDR--TLMYYLQQLITHENYNPDALTNDIALMFING------YIPWNWPTVT 155
            ..:|:|......|.:|  ||..:..:|  ||.::.....:|:||:.:.|      .:.   |.|.
  Rat   412 LTVVLGQDRHNQSCERCQTLAVHSYRL--HEGFSSKTYQHDLALLRLRGRKNSCAILS---PHVQ 471

  Fly   156 ALALNSQLVATNTD--CLISGWGLLQQNGTFSSNTLQAATVPIVSYTTC---RISYNSIPVSQVC 215
            .:.|.|.....:..  |.::|||...:.....:..||.|.||.:|...|   .:..::|....:|
  Rat   472 PVCLPSSAAPPSETVLCEVAGWGHQFEGAEEYATFLQEAQVPFISLDRCSSSNVHGDAILPGMLC 536

  Fly   216 AGYLSGGVDACQGDSGGPMSCN-GM------LAGIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
            ||:|.||.||||||||||:.|: |:      |.|::|:|:||.....|||||:|:.|.|||
  Rat   537 AGFLEGGADACQGDSGGPLVCDEGVTERQLTLRGVISWGSGCGDRNKPGVYTDVANYLDWI 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 78/254 (31%)
Tryp_SPc 35..272 CDD:238113 80/255 (31%)
F12NP_001014028.1 FN2 40..87 CDD:238019
EGF_CA 95..130 CDD:238011
FN1 132..170 CDD:238018
EGF 177..207 CDD:278437
Kringle 216..294 CDD:278480
Tryp_SPc 361..597 CDD:214473 78/254 (31%)
Tryp_SPc 362..600 CDD:238113 80/255 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.