DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Elane

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:265 Identity:79/265 - (29%)
Similarity:115/265 - (43%) Gaps:39/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGV 71
            :||:.|...||||              :||||..|......:.||::..        .||.||..
  Rat    19 LLALLLVCPALAS--------------EIVGGRPAQPHAWPFMVSLQRR--------GGHFCGAT 61

  Fly    72 VISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTN 136
            :|::..|.:||||   .:.:.:::.   .:|:|:..| ...:.|...:..|.|....::|..|.|
  Rat    62 LIARNFVMSAAHC---VNGRNFQSV---QVVLGAHDL-RRREPTRQIFSVQRIFENGFDPSRLLN 119

  Fly   137 DIALMFINGYIPWNWPT-VTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYT 200
            ||.::.:||....|... |..|....|.|...|.|:..|||.|..|....| .||...|.:|: .
  Rat   120 DIVIIQLNGSATINANVQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPS-VLQELNVTVVT-N 182

  Fly   201 TCRISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSY-GAGCAAPGYPGVYTNVSY 264
            .||...|      ||..........|.||||||:.||.::.||.|: ..||.:..||..:..|:.
  Rat   183 LCRRRVN------VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVAE 241

  Fly   265 YYDWI 269
            :.|||
  Rat   242 FADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 70/236 (30%)
Tryp_SPc 35..272 CDD:238113 72/237 (30%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 70/236 (30%)
Tryp_SPc 33..249 CDD:238113 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.