DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Klk1c3

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:291 Identity:81/291 - (27%)
Similarity:132/291 - (45%) Gaps:58/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VW-AILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHL 67
            :| .||.:||.||.:        :.|...:.::|||:........:||::   .|:       .|
  Rat     1 MWFLILFLALSLGQI--------DAAPPGQSRVVGGFKCEKNSQPWQVAV---INE-------DL 47

  Fly    68 CGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPD 132
            ||||:|....|.|||||          .:..:.:::|...|:......|   :.|...|.:|.|.
  Rat    48 CGGVLIDPSWVITAAHC----------YSDNYHVLLGQNNLSEDVQHRL---VSQSFRHPDYKPF 99

  Fly   133 AL----------TNDIALMFINGYIPWNWPT-----VTALALNSQLVATNTDCLISGWGLLQQNG 182
            .:          :||:.|:.::.      |.     |..:.|.::.....:.||:||||....:.
  Rat   100 LMRNHTRKPKDYSNDLMLLHLSE------PADITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPSE 158

  Fly   183 TFSSNTLQAATVPIVSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSY 246
            ....:.||...:.::|...|..:| ..:....:|||.|.||.|.|:||||||:.|:|:|.||.|:
  Rat   159 WEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSW 223

  Fly   247 GA-GCAAPGYPGVYTNVSYYYDWI---VQKN 273
            |: .|..|..||:||.:..:..||   ::||
  Rat   224 GSVPCGEPNKPGIYTKLIKFTSWIKEVMKKN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 69/251 (27%)
Tryp_SPc 35..272 CDD:238113 71/256 (28%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 69/251 (27%)
Tryp_SPc 25..250 CDD:238113 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.