DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Klk9

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:278 Identity:88/278 - (31%)
Similarity:128/278 - (46%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVV 72
            |.:.|.|.:|.:|. ..::|      :.||..:.......:|..:        .|.:..|||..:
  Rat     3 LGLTLVLFSLLAGH-CGADT------RAVGARECQRNSQPWQAGL--------FYLTRQLCGATL 52

  Fly    73 ISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTN- 136
            |:.:.:.|||||     :|.|     ..:.:|..:|........:..:.....|..:|||...| 
  Rat    53 INDQWLLTAAHC-----RKPY-----LWVRLGEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSAND 107

  Fly   137 ---DIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVS 198
               ||.|:.:...:..: |.|..|.|:..|.:..|.|||||||.:..:......|||.|.:.|:.
  Rat   108 HNDDIMLIRLPRKVRLS-PAVQPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILD 171

  Fly   199 YTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGA-GCAAPGYPGVYTN 261
            ...||.:| ..|....:|||...||..:||||||||:.|.|.||||||.|: .|:.|..|.|||:
  Rat   172 NKLCRWAYPGHISEKMLCAGLWEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTS 236

  Fly   262 VSYYYDWIVQKNSSLNYT 279
            |.:|.|||.......|:|
  Rat   237 VFHYLDWIENTVEKYNHT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 78/240 (33%)
Tryp_SPc 35..272 CDD:238113 80/242 (33%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.