DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Klk10

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:287 Identity:75/287 - (26%)
Similarity:117/287 - (40%) Gaps:58/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASI-EQVSYQVSIRLTANDKKSYGS 64
            |.::||  |.||.|....:.|.|  |..|.:.|.:...:..|: ..:.:|               
  Rat    26 MMQLWA--AQALLLPGNTTREDL--EAFGTLCPSVSQPWQVSLFHNLQFQ--------------- 71

  Fly    65 GHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENY 129
               |.||::.|..|.|||| |:.....:.|...:.:|:..|..|.|:...         :.|..|
  Rat    72 ---CAGVLVDQNWVLTAAH-CWRNKPLRARVGDDHLLLFQSEQLRSTNSP---------VFHPKY 123

  Fly   130 NP--------DALTNDIALMFINGYIPWNWPTVTA-----LALNSQLVATNTDCLISGWGLLQQN 181
            .|        .:..:|:.::.::.      |.|..     :.|..|......:|.:||||.....
  Rat   124 QPCSGPVLPLRSDEHDLMMLKLSS------PVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANR 182

  Fly   182 GTFSSNTLQAATVPIVSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVS 245
            ....:.:|..:.|.::|...|...| ..|..:.:||| :....|:||.|||||:.|:..|.||:|
  Rat   183 RVKYNRSLSCSRVTLLSQKQCETFYPGVITNNMICAG-MDRDQDSCQSDSGGPLVCDNTLHGILS 246

  Fly   246 ---YGAGCAAPGYPGVYTNVSYYYDWI 269
               |..| ||..||.||..:..|.:||
  Rat   247 WSIYPCG-AATQYPAVYAKICNYTNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 61/252 (24%)
Tryp_SPc 35..272 CDD:238113 63/253 (25%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 63/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.