DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Klk11

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:286 Identity:88/286 - (30%)
Similarity:130/286 - (45%) Gaps:61/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSI----RLTANDKKSYGSGHLC 68
            :|:||..|.:..            |.:|:.||:.......:||::    ||            ||
  Rat    36 IALALVTGHVGG------------ETRIIKGYECRPHSQPWQVALFQKTRL------------LC 76

  Fly    69 GGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDA 133
            |..:|:.:.:.|||||     :|.:     :|:::|...|..:..........:...|..:| ::
  Rat    77 GATLIAPKWLLTAAHC-----RKPH-----YVILLGEHNLEKTDGCEQRRMATESFPHPGFN-NS 130

  Fly   134 L-----TNDIALM------FINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSN 187
            |     .|||.|:      ||.       ..|..|.|:|..|...|.|||||||..........:
  Rat   131 LPNKDHRNDIMLVKMSSPAFIT-------RAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPH 188

  Fly   188 TLQAATVPIVSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAG-C 250
            :|:.|.|.|:.:..|..:| .:|..:.:||.....|.|:||||||||:.|||.|.||:|:|.. |
  Rat   189 SLRCANVSIIGHKECERAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPC 253

  Fly   251 AAPGYPGVYTNVSYYYDWI--VQKNS 274
            |....|||||.|..|:|||  |.:|:
  Rat   254 AVTRKPGVYTKVCKYFDWIHEVMRNN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 79/251 (31%)
Tryp_SPc 35..272 CDD:238113 82/255 (32%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 79/251 (31%)
Tryp_SPc 51..275 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.