DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Mcpt2

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:271 Identity:79/271 - (29%)
Similarity:119/271 - (43%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQR 76
            |||.||.......:|       :|:||.::......|...:.:....    |...:|||.:||::
  Rat     5 LFLMALLLPSGAGAE-------EIIGGVESIPHSRPYMAHLDIVTEK----GLRVICGGFLISRQ 58

  Fly    77 LVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALM 141
            .|.|||||       |.|   |..:::|:..:...........:::.|.||:||.....:||.|:
  Rat    59 FVLTAAHC-------KGR---EITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLL 113

  Fly   142 FINGYIPWNWPTVTALAL--NSQLVATNTDCLISGWGLLQQNGTF--SSNTLQAATVPIVSYTTC 202
            .:...:... |.|..:.|  .|..:.....|..:|||   :.|..  :|.||:...:.|:....|
  Rat   114 KLEKKVELT-PAVNVVPLPSPSDFIHPGAMCWAAGWG---KTGVRDPTSYTLREVELRIMDEKAC 174

  Fly   203 RISYNSIPVS-QVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYY 266
             :.|...... |||.|..:....|..||||||:.|.|:..||||||...|.|  |.::|.||.|.
  Rat   175 -VDYRYYEYKFQVCVGSPTTLRAAFMGDSGGPLLCAGVAHGIVSYGHPDAKP--PAIFTRVSTYV 236

  Fly   267 DWIVQKNSSLN 277
            .||   |:.:|
  Rat   237 PWI---NAVIN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 69/239 (29%)
Tryp_SPc 35..272 CDD:238113 71/241 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 69/239 (29%)
Tryp_SPc 21..242 CDD:238113 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.