DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Prss38

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:272 Identity:80/272 - (29%)
Similarity:133/272 - (48%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVI 73
            ::.|||.:.....:|..        |::||......:..:||||.        |...|:|||.::
  Rat    96 SLHLFLSSACGQPALHG--------KLLGGELTIDRKWPWQVSIH--------YAGFHVCGGSIL 144

  Fly    74 SQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITH---ENYNPDALT 135
            :...|.|||||  ...:|:.:|   |.:.:|.|.|..:...|..:.:.|:|.|   |.::|  :.
  Rat   145 NAYWVLTAAHC--FAREKRLQT---FDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHP--VG 202

  Fly   136 NDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYT 200
            .|:||:.....|.::...:.....:|.|..::..|..:|||::...|....:.|: |.:|::...
  Rat   203 GDVALVQSKSAIVFSDYVLPICLPSSNLNLSDLSCWTTGWGMVSPQGETGKDLLE-AQLPLIPKF 266

  Fly   201 TCRISYN----SIPVSQVCAGYLSGGVDACQGDSGGPMSC----NGMLAGIVSYGAGCAAPGYPG 257
            .|::.|.    .:| ..:|||.:....:.|:||||.|:.|    ..:..||||:|.|||.|.|||
  Rat   267 QCQLLYGLTSYLLP-EMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPG 330

  Fly   258 VYTNVSYYYDWI 269
            |:.||||:.:||
  Rat   331 VFANVSYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 74/245 (30%)
Tryp_SPc 35..272 CDD:238113 75/246 (30%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 75/244 (31%)
Tryp_SPc 116..342 CDD:214473 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.