DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and LOC286960

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:267 Identity:97/267 - (36%)
Similarity:136/267 - (50%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVV 72
            :.|::|...|.:..:|....    :.||||||......|.||||:    :|    |..|.|||.:
  Rat     1 MKISIFFAFLGAAVALPVND----DDKIVGGYTCPKHLVPYQVSL----HD----GISHQCGGSL 53

  Fly    73 ISQRLVATAAHCCYITDKKKYRT-AGE---FVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDA 133
            ||.:.|.:||||.    |:|.:. .||   .||..|..::.:          :::|.|..||.|.
  Rat    54 ISDQWVLSAAHCY----KRKLQVRLGEHNIHVLEGGEQFIDA----------EKIIRHPEYNKDT 104

  Fly   134 LTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVS 198
            |.|||.|:.:......| ..|:.::|.....:|:..||:||||.....|......||....|::|
  Rat   105 LDNDIMLIKLKSPAVLN-SQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLS 168

  Fly   199 YTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNV 262
            .::|:.|| ..|..:..|.|:|.||.|:|.||||||:.|||.:.||||:|:.||..|.|||||.|
  Rat   169 ASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKV 233

  Fly   263 SYYYDWI 269
            ..|..||
  Rat   234 CNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 91/239 (38%)
Tryp_SPc 35..272 CDD:238113 92/240 (38%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 91/239 (38%)
Tryp_SPc 24..243 CDD:238113 92/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.