DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Prss3b

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:275 Identity:98/275 - (35%)
Similarity:142/275 - (51%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGG 70
            |::.:| |||| |....|..:     :.||||||......:.||||:.         ...|.|||
  Rat     3 ALIFLA-FLGA-AVALPLDDD-----DDKIVGGYTCQKNSLPYQVSLN---------AGYHFCGG 51

  Fly    71 VVISQRLVATAAHCCYITDKKKYRT-----AGEF---VLVMGSTYLTSSTDRTLMYYLQQLITHE 127
            .:|:.:.|.:||||        |::     .||.   |:..|..::.::          ::|.|.
  Rat    52 SLINSQWVVSAAHC--------YKSRIQVRLGEHNIDVVEGGEQFIDAA----------KIIRHP 98

  Fly   128 NYNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAA 192
            :||.:...|||.|:.:|.....| ..|:.::|.....::.|.||:||||....:||...:.||..
  Rat    99 SYNANTFDNDIMLIKLNSPATLN-SRVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCL 162

  Fly   193 TVPIVSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYP 256
            ..|::|.::|:.|| ..|..:..|.|:|.||.|:||||||||:.|||.|.|:||:|.|||..|.|
  Rat   163 DAPVLSDSSCKSSYPGKITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKP 227

  Fly   257 GVYTNVSYYYDWIVQ 271
            ||||.|..|.:||.|
  Rat   228 GVYTKVCNYVNWIQQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 87/243 (36%)
Tryp_SPc 35..272 CDD:238113 89/246 (36%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 87/243 (36%)
Tryp_SPc 25..243 CDD:238113 89/246 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.