DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and KLK9

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:218 Identity:80/218 - (36%)
Similarity:105/218 - (48%) Gaps:23/218 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GSGHL----CGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQL 123
            |..||    ||..:||.|.:.|||||     :|.|     ..:.:|..:|........::.:...
Human    39 GLFHLTRLFCGATLISDRWLLTAAHC-----RKPY-----LWVRLGEHHLWKWEGPEQLFRVTDF 93

  Fly   124 ITHENYNPDALTND--IALMFINGYIPWN---WPTVTALALNSQLVATNTDCLISGWGLLQQNGT 183
            ..|..:|.|...||  ..:|.|.  :|..   .|.|..|.|:...|:....|||||||.:.....
Human    94 FPHPGFNKDLSANDHNDDIMLIR--LPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKA 156

  Fly   184 FSSNTLQAATVPIVSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG 247
            ....|||.|.:.|:....|..:| ..|..|.:|||...||..:||||||||:.|||.|||:||.|
Human   157 LFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGG 221

  Fly   248 A-GCAAPGYPGVYTNVSYYYDWI 269
            | .|:.|..|.|||:|.:|.|||
Human   222 AEPCSRPRRPAVYTSVCHYLDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 78/216 (36%)
Tryp_SPc 35..272 CDD:238113 80/218 (37%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 80/218 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.