DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Prss38

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:293 Identity:89/293 - (30%)
Similarity:139/293 - (47%) Gaps:48/293 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLGALAS---------------GESLSSETA-GK--IEPKIVGGYDASIEQVSYQVSIR 53
            :|...||...|||               ..|||.:.| |:  ::.|::||..|...:..:|||:.
Mouse    10 VLGYLLFPLLLASPTWVTSVSRRHPKSQANSLSGDVACGQPVLQGKLLGGEFARDRKWPWQVSLH 74

  Fly    54 LTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDK-KKYRTAGEFVLVMGSTYLTSSTDRTLM 117
                    |...|:|||.::|...|.:||||   .|: ||..|   :.:.:|.|.|..:...|..
Mouse    75 --------YSGFHICGGSILSAYWVLSAAHC---FDRGKKLET---YDIYVGITNLEKANRHTQW 125

  Fly   118 YYLQQLITH---ENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQ 179
            :.:.|:|.|   :.|:|  :..|:||:.:...|.::...:......|.|...|..|..:|||::.
Mouse   126 FEIYQVIIHPTFQMYHP--IGGDVALVQLKSAIVFSDFVLPICLPPSDLYLINLSCWTTGWGMIS 188

  Fly   180 QNGTFSSNTLQAATVPIVSYTTCRISYN----SIPVSQVCAGYLSGGVDACQGDSGGPMSC---- 236
            ..|. :.|.|..|.:|::....|::.|.    .:| ..:||..:....:.|:||||.|:.|    
Mouse   189 PQGE-TGNELLEAQLPLIPRFQCQLLYGLSSYLLP-EMLCAADIKTMKNVCEGDSGSPLVCKQNQ 251

  Fly   237 NGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
            ..:..||||:|.|||.|.||||:.||||:..||
Mouse   252 TWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 76/246 (31%)
Tryp_SPc 35..272 CDD:238113 77/247 (31%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 77/245 (31%)
Tryp_SPc 58..284 CDD:214473 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.