DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and PRSS55

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:293 Identity:80/293 - (27%)
Similarity:133/293 - (45%) Gaps:43/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGE 98
            :|.||.:|.:.:..:||||:..        |...|||.::::..:.|||||.|    .:.....|
Human    67 RITGGMEAEVGEFPWQVSIQAR--------SEPFCGGSILNKWWILTAAHCLY----SEELFPEE 119

  Fly    99 FVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQL 163
            ..:|:|:..|||.:..  :..:..:|.|:::....:.|||||:.:...|..:...|.........
Human   120 LSVVLGTNDLTSPSME--IKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQPG 182

  Fly   164 VATNTDCLISGWGLLQQNGTFSSNT---LQAATVPIVSYTTCRISYNSIPVSQVCAGYLSGGVDA 225
            .||..:|.::|||  |.|....::.   |..|.:.|:.:..|...:..:..:.:||||.:...||
Human   183 PATWRECWVAGWG--QTNAADKNSVKTDLMKAPMVIMDWEECSKMFPKLTKNMLCAGYKNESYDA 245

  Fly   226 CQGDSGGPMSC------NGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNSSLNYTIYH-- 282
            |:||||||:.|      .....||:|:|..|.....||:||::..|..|| :|.:.|....::  
Human   246 CKGDSGGPLVCTPEPGEKWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWI-EKVTQLEGRPFNAE 309

  Fly   283 ---------------NGGVRQGSSWSYLGILPL 300
                           :|....||..|:|.:.||
Human   310 KRRTSVKQKPMGSPVSGVPEPGSPRSWLLLCPL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 69/243 (28%)
Tryp_SPc 35..272 CDD:238113 71/245 (29%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 69/243 (28%)
Tryp_SPc 68..298 CDD:238113 71/246 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330 1/21 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.