DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Prtn3

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:267 Identity:84/267 - (31%)
Similarity:121/267 - (45%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVV 72
            |.:||.:|......            |||||::|......|..|::|:     .:...|.|||.:
Mouse    15 LLLALVVGGAVQAS------------KIVGGHEARPHSRPYVASLQLS-----RFPGSHFCGGTL 62

  Fly    73 ISQRLVATAAHCCYITDKKKYRTAGEFV-LVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTN 136
            |..|.|.|||||  :.|     .:.:.| :|:|:..|.||......:.:.| :...||||:...|
Mouse    63 IHPRFVLTAAHC--LQD-----ISWQLVTVVLGAHDLLSSEPEQQKFTISQ-VFQNNYNPEENLN 119

  Fly   137 DIALMFINGYIPWNWP-TVTALALNSQLVATNTDCLISGWGLLQQNGTF--SSNTLQAATVPIVS 198
            |:.|:.:|........ .|.:|....|.::..|.||..|||.|   ||.  :...||...|.:|:
Mouse   120 DVLLLQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRL---GTQAPTPRVLQELNVTVVT 181

  Fly   199 YTTCRISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG-AGCAAPGYPGVYTNV 262
            : .|| .:|      ||..........|.||||||:.|||:|.|:.|:. ..||:..:|..:..|
Mouse   182 F-LCR-EHN------VCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARV 238

  Fly   263 SYYYDWI 269
            |.|.|||
Mouse   239 SMYVDWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 78/239 (33%)
Tryp_SPc 35..272 CDD:238113 79/240 (33%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 78/239 (33%)
Tryp_SPc 30..248 CDD:238113 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.