DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and try-1

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:317 Identity:97/317 - (30%)
Similarity:139/317 - (43%) Gaps:71/317 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVWAILAIALFLGALAS----------GESLSS------ETAGKIEP--------KIVGGYDASI 43
            |||..|.:...:..:::          |..|.|      :|....||        :::||.::|.
 Worm     2 KVWIFLLLVGVINKVSTDNKNDVIEKVGCGLHSTNVELAQTRSAQEPADYVTLDHRLIGGSESSP 66

  Fly    44 EQVSYQVSI--RLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGST 106
            ....:.|.:  ||         ..|.|||.:|....|.|||| |:..|:   |.....|.|.|..
 Worm    67 HSWPWTVQLLSRL---------GHHRCGGSLIDPNFVLTAAH-CFAKDR---RPTSYSVRVGGHR 118

  Fly   107 YLTSSTDRTLMYYLQQLITHENYN---PDALTNDIALMFINGYIPWNWPTVT-ALALNSQLVATN 167
            ..:.|..|     :..:..|..||   |.:.  |.|:|.|  :.|.|..|.. .:.|.|.....|
 Worm   119 SGSGSPHR-----VTAVSIHPWYNIGFPSSY--DFAIMRI--HPPVNTSTTARPICLPSLPAVEN 174

  Fly   168 TDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISYNSIP--------VSQVCAGYLSGGVD 224
            ..|:::|||...:..:.|:.||:...||::|...|    :|:|        .|.:||||..|.:|
 Worm   175 RLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFC----SSLPNYIGRIHLPSMLCAGYSYGKID 235

  Fly   225 ACQGDSGGPMSC----NGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNSSLN 277
            :||||||||:.|    :..|.|:||:|.|||.||.||||.||.....||   |..:|
 Worm   236 SCQGDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI---NLEMN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 83/252 (33%)
Tryp_SPc 35..272 CDD:238113 85/254 (33%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 85/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.