DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and Klk1b27

DIOPT Version :10

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_064664.1 Gene:Klk1b27 / 16619 MGIID:891980 Length:263 Species:Mus musculus


Alignment Length:67 Identity:18/67 - (26%)
Similarity:29/67 - (43%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 SSETLQKTQESSTRQNSAARAL-LLF--LCF-YVLAELPYVLLFSVGLYNPADFEQLDEYIYSQV 236
            ::|...|..|:.:|...|.||: .||  .|| .|..:.|   |..:..|:.....|.:|...|.:
Mouse   236 ATEVCGKCGETLSRSQPAVRAMDKLFHSHCFCCVSCQRP---LQGMQFYDRDGTPQCEECYMSSL 297

  Fly   237 DI 238
            .:
Mouse   298 SV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 18/67 (27%)
Klk1b27NP_064664.1 Tryp_SPc 24..255 CDD:214473 5/18 (28%)

Return to query results.
Submit another query.