DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and PRSS36

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:260 Identity:81/260 - (31%)
Similarity:118/260 - (45%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GKIEP--KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKK 91
            |:.||  :||||.:|......:|||:.        :|.||:|||.:|:...|.:||| |::|: .
Human    39 GRPEPSARIVGGSNAQPGTWPWQVSLH--------HGGGHICGGSLIAPSWVLSAAH-CFMTN-G 93

  Fly    92 KYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYI---PWNWPT 153
            ....|.|:.:::|........|......:..::...||:...|..|:||:.:....   |..|| 
Human    94 TLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWP- 157

  Fly   154 VTALALNSQLVATNTDCLISGWGLLQQNGTFSSN-TLQAATVPIVSYTTCRISYN---------S 208
             ..|...|......|.|..:|||.:|:....... .||...:.::...||:..|:         .
Human   158 -VCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQ 221

  Fly   209 IPVSQVCAGYLSGGVDACQGDSGGPMSC----NGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWI 269
            |....:||||..|..|.||||||||:.|    ....|||.|:|.||.....|||:|.|:.|..||
Human   222 ILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWI 286

  Fly   270  269
            Human   287  286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 76/251 (30%)
Tryp_SPc 35..272 CDD:238113 78/252 (31%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 76/251 (30%)
Tryp_SPc 47..289 CDD:238113 78/252 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.