DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and LOC101730924

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:265 Identity:96/265 - (36%)
Similarity:136/265 - (51%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG-HLCGG 70
            :|.:.:.|||.|:.:          :.||:||...:...|.|.||:          .|| |.|||
 Frog     3 LLLLCVLLGAAAAFD----------DDKIIGGATCAKNSVPYIVSL----------NSGYHFCGG 47

  Fly    71 VVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALT 135
            .:|:.:.|.:||||        |:.:.:..|...:..|:..|::.:.  ..::|.|..||...|.
 Frog    48 SLINNQWVVSAAHC--------YKASIQVRLGEHNIALSEGTEQFIS--SSKVIRHSGYNSWTLD 102

  Fly   136 NDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYT 200
            |||.|:.::.....| ..|.|:||.|...|..|.|||||||....:|:...:.||....||::..
 Frog   103 NDIMLIKLSSAASLN-AAVNAVALPSGCAAAGTSCLISGWGNTLSSGSNYPDLLQCLYAPILTDA 166

  Fly   201 TCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSY 264
            .|..:| ..|..:.:|.|:|.||.|:||||||||:.|||.|.|:||:|.|||...||||||.|..
 Frog   167 QCNNAYPGEITNNMICLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCN 231

  Fly   265 YYDWI 269
            |..||
 Frog   232 YNSWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 89/236 (38%)
Tryp_SPc 35..272 CDD:238113 90/237 (38%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 90/237 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.