DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and LOC100498532

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:279 Identity:89/279 - (31%)
Similarity:129/279 - (46%) Gaps:31/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKVWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSG 65
            |..:|    :.:|| |:|:...|..:     :.||||||:.:.....:||..        :|..|
 Frog     1 MMPLW----VLMFL-AVAAAAPLDDD-----DDKIVGGYECTPHSQPWQVLF--------TYNGG 47

  Fly    66 HLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYN 130
            :.|||.:||.|.:.:||||        |:.....|.::|...|...........::....|..|.
 Frog    48 NWCGGSLISPRWIISAAHC--------YQPPKTLVALLGEHDLKKKEGTEQHIQVEAAYKHFGYK 104

  Fly   131 PDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVP 195
            ..|..:||.|:.:.....:| ..|..:.:..........||:||:|.:........:.||...||
 Frog   105 DKAHDHDIMLVKLAKPAQYN-QYVQPIPVARSCPTDGAKCLVSGFGNVLGYNVRYPDQLQCLEVP 168

  Fly   196 IVSYTTCRISY-NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAG-CAAPGYPGV 258
            |||.::|:.|| ..|..:..|||:|.||..:|.||||||:.|||.|.|.||:|.. |.:...|||
 Frog   169 IVSDSSCKASYPRMISENMFCAGFLEGGKGSCHGDSGGPLICNGELYGAVSWGGSYCISKNSPGV 233

  Fly   259 YTNVSYYYDWIVQKNSSLN 277
            |..|..|.|||  ||.:.|
 Frog   234 YAKVCNYLDWI--KNITEN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 77/236 (33%)
Tryp_SPc 35..272 CDD:238113 78/238 (33%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.