DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6041 and zgc:171509

DIOPT Version :9

Sequence 1:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:258 Identity:89/258 - (34%)
Similarity:126/258 - (48%) Gaps:45/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGE 98
            ||:||::.......:|..:      ...||   ||||.:|.:..|.:||||          .:..
Zfish    20 KIIGGHECQPHSQPWQARL------DDGYG---LCGGSLIHESWVVSAAHC----------KSSS 65

  Fly    99 FVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFI-------NGYIPWNWPTVTA 156
            .::.:|...|....|.......:::|:|..||.....|||.|:.:       |...|...||..:
Zfish    66 IIVHLGKHDLFVVEDTAQEIQAEKVISHPKYNNREHNNDIMLIKLREPAVINNNVKPVPLPTNCS 130

  Fly   157 LALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISYNSIPVSQV-CAGYLS 220
            .|        ...||:||||:   .|...|:|||...:||:|...|:.:|..:...:: |||::.
Zfish   131 HA--------GEQCLVSGWGV---TGDSISSTLQCLELPILSKADCKSAYGRVITKKMFCAGFMD 184

  Fly   221 GGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNSSLNYTIYHN 283
            ||.|:||||||||:.|||.|.||||:|.|||.||:||||..|..|.:||       ||.|.:|
Zfish   185 GGKDSCQGDSGGPVVCNGTLKGIVSFGIGCAEPGFPGVYVEVCRYINWI-------NYIIANN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 83/242 (34%)
Tryp_SPc 35..272 CDD:238113 84/244 (34%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 83/242 (34%)
Tryp_SPc 21..234 CDD:238113 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.