DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3726 and KLHL15

DIOPT Version :9

Sequence 1:	NP_001284917.1	Gene:	CG3726 / 31525	FlyBaseID:	FBgn0029824	Length:	682	Species:	Drosophila melanogaster
Sequence 2:	NP_085127.2	Gene:	KLHL15 / 80311	HGNCID:	29347	Length:	604	Species:	Homo sapiens

Alignment Length:	96	Identity:	27/96 - (28%)
Similarity:	48/96 - (50%)	Gaps:	1/96 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 HHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERD-PIIIMKDV 76
            |.:::...|..|.:.|...||||..|....:||:.:|...|.:|..:.:....||| ..|.:|.:
Human    13 HDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQDKIHLKGL 77

  Fly    77 TFAEVKCLIEFMYKGEINVEHSSLPSLLKTA 107
            |......:::|||.|.|.:..:::..:|:.|
Human    78 TATGFSHVLQFMYYGTIELSMNTVHEILQAA 108

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3726	NP_001284917.1	BTB	21..118	CDD:279045	26/88 (30%)
		BTB	32..121	CDD:197585	23/77 (30%)
		HTH_psq	587..622	CDD:283007
KLHL15	NP_085127.2	BTB	33..576	CDD:333434	22/76 (29%)
		KELCH repeat	321..365	CDD:276965
		Kelch 1	328..379
		KELCH repeat	369..412	CDD:276965
		Kelch 2	381..426
		KELCH repeat	417..474	CDD:276965
		Kelch 3	428..473
		KELCH repeat	478..529	CDD:276965
		Kelch 4	489..542
		KELCH repeat	532..572	CDD:276965
		Kelch 5	544..590
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910