DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3726 and KLHL36

DIOPT Version :9

Sequence 1:	NP_001284917.1	Gene:	CG3726 / 31525	FlyBaseID:	FBgn0029824	Length:	682	Species:	Drosophila melanogaster
Sequence 2:	NP_079007.2	Gene:	KLHL36 / 79786	HGNCID:	17844	Length:	616	Species:	Homo sapiens

Alignment Length:	108	Identity:	35/108 - (32%)
Similarity:	63/108 - (58%)	Gaps:	7/108 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 RWKYHHSN-LQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLS---NYASERDP 69
            ||..|.|. ||.:..|.| ||.||||.|..:.|.:.|||.:|..||.:|:::.:   ..|.:::.
Human    24 RWADHSSTVLQRLNEQRL-RGLFCDVVLVADEQRVPAHRNLLAVCSDYFNSMFTIGMREAFQKEV 87

  Fly    70 IIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKI 112
            .:|  ..::..:|.:::|:|.||:.::..::..:|:||..|:|
Human    88 ELI--GASYIGLKAVVDFLYGGELVLDGGNIDYVLETAHLLQI 128

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3726	NP_001284917.1	BTB	21..118	CDD:279045	29/95 (31%)
		BTB	32..121	CDD:197585	23/84 (27%)
		HTH_psq	587..622	CDD:283007
KLHL36	NP_079007.2	BTB	36..139	CDD:279045	29/96 (30%)
		PHA03098	45..585	CDD:222983	25/86 (29%)
		BACK	149..250	CDD:285009
		Kelch 1	296..345
		Kelch	<317..345	CDD:128874
		Kelch_1	334..384	CDD:279660
		KELCH repeat	335..383	CDD:276965
		Kelch 2	346..397
		Kelch_1	386..431	CDD:279660
		KELCH repeat	387..431	CDD:276965
		Kelch 3	398..444
		KELCH repeat	434..481	CDD:276965
		Kelch	446..493	CDD:128874
		Kelch 4	446..493
		KELCH repeat	483..533	CDD:276965
		Kelch_1	486..532	CDD:279660
		Kelch 5	494..546
		KELCH repeat	536..582	CDD:276965
		Kelch 6	547..595
		Kelch	547..593	CDD:128874
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	597..616
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910