DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and klhl24

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001072337.1 Gene:klhl24 / 779790 XenbaseID:XB-GENE-1000313 Length:600 Species:Xenopus tropicalis


Alignment Length:164 Identity:39/164 - (23%)
Similarity:79/164 - (48%) Gaps:13/164 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERDPIIIMKDVT 77
            |..::..:|::..:...|.||.:..||:....||.:|.|||::|.|:..|...|...:::..:..
 Frog    48 HSESILQVFNEFRENRLFTDVIICVEGREFPCHRAILSACSSYFRAMFCNDHRESREMLVEINGI 112

  Fly    78 FAE-VKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAEVTWRDDEDGPPPPMAA-----AEF 136
            ||| :.|.::::|.|.:.:...::..|.:|:...:|..|.:...:..|:...|....     |:.
 Frog   113 FAEAMDCFLQYVYTGRVKITTENVQYLFETSSLFQISVLRDACAKFLEEQLDPCNCLGIQHFADT 177

  Fly   137 HS------PPRSLAESYAQDLILQHQQQQQQGPA 164
            ||      ..:|.|:...:| ::||::..:.|.|
 Frog   178 HSLKTLFTKCKSFAQQAFED-VVQHEEFLELGKA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 26/97 (27%)
BTB 32..121 CDD:197585 24/89 (27%)
HTH_psq 587..622 CDD:283007
klhl24NP_001072337.1 BTB_POZ_KLHL24_KRIP6 48..168 CDD:349562 29/119 (24%)
PHA03098 59..566 CDD:222983 37/153 (24%)
KELCH repeat 354..393 CDD:276965
KELCH repeat 397..441 CDD:276965
KELCH repeat 444..489 CDD:276965
KELCH repeat 492..529 CDD:276965
KELCH repeat 536..578 CDD:276965
Kelch 545..591 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.