DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and Zbtb43

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001342539.1 Gene:Zbtb43 / 71834 MGIID:1919084 Length:504 Species:Mus musculus


Alignment Length:426 Identity:82/426 - (19%)
Similarity:142/426 - (33%) Gaps:152/426 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFF--DAVLSNYASERDPIIIMKDVT 77
            |.:....:|...:|..|||::..:|.:.:||:.||.|.|.:|  ..:|.|  |.|   |::.||.
Mouse    54 STILQKLNQQRQQGQLCDVSIVVQGHIFQAHKAVLAASSPYFCDQVLLKN--SRR---IVLPDVM 113

  Fly    78 FAEV-KCLIEFMYKGEINVEHSSLPSLLKTADDLK----IKGLAEVTWRDDEDGPPPPMA----- 132
            ...| :.::.|.|.|.:.:....:.|.|..|..|:    :....||.     :|.|..:.     
Mouse   114 NPRVFENILLFSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCTEVL-----EGNPTVLCQKLNH 173

  Fly   133 AAEFHSPPRS----LAESY------------AQDLILQHQQQQQQGPAAPPLNLHSSAALLERDR 181
            .::..||..|    |.||:            ||:|                           ||.
Mouse   174 GSDHQSPSSSNYNGLVESFELGSGGHTDFPKAQEL---------------------------RDG 211

  Fly   182 ERERERDRERLSPGMEGVLGRMPVMTPLTGASGSAGVGSVSGGTSLEGVAPVEHFLGPKRKRGRP 246
            |.|.|..::.||                         ..|:....|...:..||           
Mouse   212 ENEEESTKDELS-------------------------SQVTEHEYLPSNSSTEH----------- 240

  Fly   247 PLDDAYDVFNVRKLAQYAANLEPAQRAYLETARHFT----EEPPLAAHAASMASPPAACPPKQRQ 307
                       .:|:...|:.:..:.....|..|:|    .:|.:.||...:...|        :
Mouse   241 -----------DRLSTEMASQDGEEGTNDSTEFHYTRPLYSKPSIMAHRRWIHVKP--------E 286

  Fly   308 RLR--------HQQQQQQQLLQSESSDQEQPAAGQDWSNLEPNGS------ATPKLLSDGDANKQ 358
            ||.        |....:.|:.:|.::.|...:|       :|:|:      ...|:..:.|   :
Mouse   287 RLEQAWDGMDVHAAYDEHQVTESVNTMQTDHSA-------QPSGAEEEFQIVEKKVEVEFD---E 341

  Fly   359 ETEGG--DESLPAVLTTASSSGTKKL--EKIGERRE 390
            :.||.  ||.:....::......:||  ..||.::|
Mouse   342 QAEGSSYDEQVDFYGSSMEEFSGEKLGGNLIGHKQE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 28/103 (27%)
BTB 32..121 CDD:197585 27/95 (28%)
HTH_psq 587..622 CDD:283007
Zbtb43NP_001342539.1 BTB 60..160 CDD:306997 29/104 (28%)
C2H2 Zn finger 413..431 CDD:275368
C2H2 Zn finger 439..459 CDD:275368
zf-H2C2_2 451..474 CDD:316026
C2H2 Zn finger 467..484 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.