powered by:
Protein Alignment CG3726 and bach1a
DIOPT Version :9
Sequence 1: | NP_001284917.1 |
Gene: | CG3726 / 31525 |
FlyBaseID: | FBgn0029824 |
Length: | 682 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001035403.1 |
Gene: | bach1a / 678555 |
ZFINID: | ZDB-GENE-060421-7601 |
Length: | 174 |
Species: | Danio rerio |
Alignment Length: | 50 |
Identity: | 15/50 - (30%) |
Similarity: | 22/50 - (44%) |
Gaps: | 7/50 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 552 RLTNEELSQWQDVIKMDDYLAKGRRPQFWEEPFTKRVLDAIKNKRLEMKK 601
:||.|:|...|||.:........:|.: ||.||.|.....::||
Zfish 14 QLTPEQLEYVQDVRRRSKNRVAAQRCR-------KRKLDCIYRLEGDIKK 56
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.