DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and bach1a

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001035403.1 Gene:bach1a / 678555 ZFINID:ZDB-GENE-060421-7601 Length:174 Species:Danio rerio


Alignment Length:50 Identity:15/50 - (30%)
Similarity:22/50 - (44%) Gaps:7/50 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 RLTNEELSQWQDVIKMDDYLAKGRRPQFWEEPFTKRVLDAIKNKRLEMKK 601
            :||.|:|...|||.:........:|.:       ||.||.|.....::||
Zfish    14 QLTPEQLEYVQDVRRRSKNRVAAQRCR-------KRKLDCIYRLEGDIKK 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045
BTB 32..121 CDD:197585
HTH_psq 587..622 CDD:283007 5/14 (36%)
bach1aNP_001035403.1 bZIP_BACH 16..86 CDD:269867 13/47 (28%)
coiled coil 20..82 CDD:269867 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.