DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and KLHL12

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_011508137.1 Gene:KLHL12 / 59349 HGNCID:19360 Length:623 Species:Homo sapiens


Alignment Length:216 Identity:52/216 - (24%)
Similarity:97/216 - (44%) Gaps:21/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASER-DPIIIMKDV 76
            |..::....:.|......|||||..|.:...|||:||.|||.:|.|:.::..||: .|.:.::.:
Human    70 HAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYFCAMFTSELSEKGKPYVDIQGL 134

  Fly    77 TFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAEVTWRDDEDGPPPP----------- 130
            |.:.::.|::|:|...::|...::..||..|..|::||:.:......|....|.           
Human   135 TASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKGVKQACCEFLESQLDPSNCLGIRDFAET 199

  Fly   131 ------MAAAEFHSPPRSLAESYAQDLILQHQQQQQQGPAAPPLNLHSSAALLER--DRERERER 187
                  |.|||..|..........::.||..|.:.::......:.:.|...:.|.  :..:..::
Human   200 HNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLIKCDEIQVDSEEPVFEAVINWVKHAKK 264

  Fly   188 DRERLSPGMEGVLGRMPVMTP 208
            :||...|.:...: |||::||
Human   265 EREESLPNLLQYV-RMPLLTP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 31/97 (32%)
BTB 32..121 CDD:197585 29/89 (33%)
HTH_psq 587..622 CDD:283007
KLHL12XP_011508137.1 BTB 78..181 CDD:279045 31/102 (30%)
PHA03098 101..556 CDD:222983 44/185 (24%)
BACK 190..291 CDD:285009 18/96 (19%)
KELCH repeat 329..370 CDD:276965
Kelch 337..384 CDD:128874
KELCH repeat 374..420 CDD:276965
Kelch 385..434 CDD:128874
KELCH repeat 424..467 CDD:276965
Kelch 436..481 CDD:128874
KELCH repeat 471..514 CDD:276965
Kelch 482..528 CDD:128874
KELCH repeat 518..562 CDD:276965
Kelch 529..575 CDD:128874
KELCH repeat 565..610 CDD:276965
Kelch 576..620 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.