DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and CG9426

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster


Alignment Length:498 Identity:107/498 - (21%)
Similarity:179/498 - (35%) Gaps:131/498 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPQQYCLRWKYHHSNLQTMF------SQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVL 60
            || .||        |.|..|      :||.::..||||.:......:.|||.||.|.|.:|:|:.
  Fly    57 LP-SYC--------NAQYPFKVLSNLNQLREQSRFCDVEIIAGMATLSAHRAVLSAASAYFEAMF 112

  Fly    61 S-----NYASERDPIIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAEVTW 120
            .     |...::..::...|.....:  |::|:|.|...:..|::..||..||.|:   |.||. 
  Fly   113 RPELGLNEVKQKSVVLHTIDGDILHI--LLDFIYTGRCEITQSNVQELLAAADMLQ---LNEVV- 171

  Fly   121 RDDEDGPPPPMAAAEFHSPPRSLAESYAQDLILQHQQQQQQGPAAPPLN-LHSS--AALLERDRE 182
                ||      ..||..  |.|..|.|..::...:....:..|...|| :|::  |..||   :
  Fly   172 ----DG------CCEFLC--RELHASNALGILRFAEAHNCESLAKSALNFVHANFPAVTLE---D 221

  Fly   183 RERERDRERLSPGMEGVLGRMPVMTPLTGASGSAGVGSVSGGTSLEGVAPVEHFLGPKRKRGRPP 247
            ...|..:..||..:...|.|:...:.:..|:                :..::|.:..:|      
  Fly   222 EFLETPQTLLSQLLNSELLRVDSESQVFQAA----------------LRWIKHDVTQRR------ 264

  Fly   248 LDDAYDVFNVRKLAQYAANLEPAQ---RAYLETARHFTEEPPLAAHAASMAS------PPAACPP 303
               .| ||:|  |:.....|.|.:   :|..:..|..:.:..|.:....:||      |...|| 
  Fly   265 ---CY-VFDV--LSHVRMALVPVKVIDKALKDDCRDMSVKIALRSICRDIASKRGQLVPLRVCP- 322

  Fly   304 KQRQRLRHQQQQQQQLLQSESSDQEQPAAGQDWSNLEPNGSATPKLLSDGDANKQE-TEGGDESL 367
                    :|..::.:.....|.::.|   :.|::.:.......|.    |..::| ||.....:
  Fly   323 --------RQLAKKNIYIIGGSHRDTP---RTWNSADCIFETVAKF----DIFRREWTETAPMEV 372

  Fly   368 PAVLTTASSSGTKKLEKIGERRERHGKLRHARRLYEKSGEDEVDPPKEEPDELPQPVEEIENEHL 432
            ..:|...|:...|.....|||..            :.....||..|:   :::.||:        
  Fly   373 GRILPGVSALNGKIYVVGGERGS------------QILANGEVYDPQ---NDVWQPI-------- 414

  Fly   433 VANRAESPRPTVVIPASFA-CKYEGGVTAAGGGSGSGTGSGSL 474
                    .|.:|....|. |...|.:.|.||..|...| ||:
  Fly   415 --------APMIVPRCEFGLCTMGGNLFAVGGWIGDDIG-GSM 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 29/107 (27%)
BTB 32..121 CDD:197585 26/93 (28%)
HTH_psq 587..622 CDD:283007
CG9426NP_609616.1 BTB 73..179 CDD:279045 34/121 (28%)
PHA03098 78..558 CDD:222983 98/468 (21%)
BACK 187..289 CDD:285009 24/132 (18%)
Kelch 330..384 CDD:128874 10/60 (17%)
KELCH repeat 374..417 CDD:276965 11/73 (15%)
Kelch 385..431 CDD:128874 13/76 (17%)
KELCH repeat 421..465 CDD:276965 10/29 (34%)
Kelch <447..478 CDD:128874 1/2 (50%)
Kelch_6 467..516 CDD:290672
KELCH repeat 468..512 CDD:276965
Kelch_1 515..557 CDD:279660
KELCH repeat 516..561 CDD:276965
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.