DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and AgaP_AGAP002297

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_565508.1 Gene:AgaP_AGAP002297 / 3290595 VectorBaseID:AGAP002297 Length:331 Species:Anopheles gambiae


Alignment Length:318 Identity:64/318 - (20%)
Similarity:124/318 - (38%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERDPIIIMKDVTFAEVKCLIEFMYKGEINVE 96
            |||:.||.:.:|||::||...|.||.::. |......|::::.:|.:.::..|::|:|.||::||
Mosquito    36 DVTICCESRKLRAHKLVLVLGSPFFRSIF-NEVPTPHPVVMIYNVKYEDLDALVKFLYTGELSVE 99

  Fly    97 HSSLPSLLKTADDLKIKGLAEVTWRDDEDGPPPPMAAAEFHSPPRSLAESYAQDLILQHQQQQQQ 161
            ...|||||:.|..|::...:.:.        |......:.:....|...::....:|..:..|..
Mosquito   100 RERLPSLLEAARYLQLDEFSTLL--------PYLQETGDLNENLLSAVNAFNSMSLLMDRTNQTN 156

  Fly   162 GPAA------------PPLNLHSSAALLERDRERERERDRERLSPGMEGVLGRMPVMTPLTGASG 214
            ..|.            || ...:||::|..:.|...::.:::|.             :|:.|...
Mosquito   157 DSATIMSTICMLTTNDPP-QPSTSASVLPYNGEAGEQQQQQQLE-------------SPINGEYL 207

  Fly   215 SAGVGSVSGGTSLEGVAPVE-----HFLGPKRKRGRP-------------PLDDAYDVFNVRKLA 261
            .....|:....|.:..:|.|     |::........|             |:|   .:.:.:..|
Mosquito   208 GDDETSMISQDSADSFSPTEVMIMPHYIDKALVSMVPRSVENAIVALFAVPID---PLISQQSAA 269

  Fly   262 QYAANLEP-----AQRAYLETARHFTEEPPLAAHAASMA----SPPAACPPKQRQRLR 310
            .:||...|     .:|...:.....::.||....|...:    :|.....|:|:...|
Mosquito   270 AFAAQNTPNAGTVDERVNDDVYLVLSDSPPAVRSARESSEFIDAPELQYDPRQQDLSR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 30/85 (35%)
BTB 32..121 CDD:197585 30/88 (34%)
HTH_psq 587..622 CDD:283007
AgaP_AGAP002297XP_565508.1 BTB 25..116 CDD:279045 30/80 (38%)
BTB 36..117 CDD:197585 30/81 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.