DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and CG32121

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001097599.1 Gene:CG32121 / 317867 FlyBaseID:FBgn0052121 Length:648 Species:Drosophila melanogaster


Alignment Length:680 Identity:163/680 - (23%)
Similarity:235/680 - (34%) Gaps:219/680 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QQYCLRWKYHHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERD 68
            ||:||||..|.::|.:....|||:....|||::.||:.:|||||||.|||:||..:.....:...
  Fly    28 QQFCLRWHNHQTSLLSTLPILLDQSHLTDVTISAEGRQLRAHRVVLSACSSFFMDIFRALEASNH 92

  Fly    69 PIIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAEV--------------T 119
            |:||:...:|..:..|:.|||.||:||....:|.||..|:.|.|||||:|              :
  Fly    93 PVIIIPGASFGAIVSLLTFMYSGEVNVYEEQIPMLLNLAETLGIKGLADVQNNNLPKTARSGGGS 157

  Fly   120 WRDDEDG-------------------------------PPPPMAAAEFHSP-------------- 139
            :.|..:.                               |.|.:.:|..::|              
  Fly   158 YMDTTNEKSSEFERPTTPSPTPTPTLTPSHTPTPSHSLPLPQLPSAALNTPLLANKLGSVNSSGM 222

  Fly   140 -------------------PRSL-----AESYAQDLILQHQQQQQQGPAAPPLNLHSSAALLERD 180
                               |:.|     |.:...:|:.::|||.|         |:.|..     
  Fly   223 GTTPLENLFKSLQFYPSLLPQPLNFSQTALNKTTELLAKYQQQCQ---------LYQSGM----- 273

  Fly   181 RERERERD---RERL---SP-----GMEGVLGRMPVMTPLTGASGSAGVGSVSGGTSLEGVAPVE 234
            :|.:.|.|   .:||   ||     .:|..|.:.|..:..|.:|.|......|....:...:||.
  Fly   274 QEDQLETDCFGSKRLKGDSPPKELRRLEKSLLKNPKSSSTTNSSSSKSPQECSNPNPIVATSPVT 338

  Fly   235 HFLGPKRKRGRPPLDDAYDVFNVRKL--AQYAANLEPAQRAYLETARHFTEEPPL---------A 288
              |.|      |.:........|.|.  |.|.:.|...|.        ::.:|||         |
  Fly   339 --LAP------PTMAHFSPQLPVVKCSSASYPSALGQGQL--------YSSKPPLYSAAVTPTAA 387

  Fly   289 AHAASMASPPAACPPKQRQRLRHQQQQQQ-QLLQSESSDQEQPAAGQDWSNLEPNGSATPKLLS- 351
            ..||.|...|...|........|.:.|.. :..|.|::.....|||   .....:..:.|.||| 
  Fly   388 QQAAQMHHHPQPGPSPYISAEDHAKLQLHIEQYQREAAAAAAAAAG---GMALVSAKSEPNLLSL 449

  Fly   352 DGDANKQETEGGDESL-PAVLTTASSSGT--------KKLEKIGERR---ERHGKLRHARRL--- 401
            ..|.        |:|| .|.:...|:|..        |:|......|   |.|..:|:|..:   
  Fly   450 SADR--------DKSLATAPIKPPSNSKLYATCFICHKQLSNQYNLRVHLETHQNVRYACNVCSH 506

  Fly   402 -------------YEKSGEDEVDPPKEEPDELPQPVEEIENEHLVANRAESPRPTVVIPASFACK 453
                         |...|             .|.|.|.......|:..|.:..||.. |.|.:..
  Fly   507 VSRSKDALRKHVSYRHPG-------------APSPCENEARRKRVSKLAATTVPTST-PMSMSAS 557

  Fly   454 YEGGVTAAGGGSGSGTGSGSLG----SSYLINEHGMLMAHEFAPNVASAAATAAVAVAAAAAAVA 514
            :.  ||:...|....|..|..|    :.||           |.||....||      ||||.|||
  Fly   558 HT--VTSGDVGPAPATTLGCSGQEARNPYL-----------FLPNQFQMAA------AAAAVAVA 603

  Fly   515 NASAGNGNGGQDVSGSGTGAAADYPDIKLE 544
            .:|..:|....|::....      |.||.|
  Fly   604 ESSPASGQPSLDLAHEAP------PSIKSE 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 42/96 (44%)
BTB 32..121 CDD:197585 40/102 (39%)
HTH_psq 587..622 CDD:283007
CG32121NP_001097599.1 BTB 48..142 CDD:279045 42/93 (45%)
BTB 56..149 CDD:197585 40/92 (43%)
C2H2 Zn finger 474..494 CDD:275370 4/19 (21%)
C2H2 Zn finger 501..518 CDD:275370 0/16 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451908
Domainoid 1 1.000 68 1.000 Domainoid score I9675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.