DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and Zbtb43

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001012094.1 Gene:Zbtb43 / 311872 RGDID:1310287 Length:503 Species:Rattus norvegicus


Alignment Length:446 Identity:89/446 - (19%)
Similarity:147/446 - (32%) Gaps:160/446 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFF--DAVLSNYASERDPIIIMKDVT 77
            |.:....:|...:|..|||::..:|.:.:||:.||.|.|.:|  ..:|.|  |.|   |::.||.
  Rat    53 STILQKLNQQRQQGQLCDVSIVVQGHIFQAHKAVLAASSPYFCDQVLLKN--SRR---IVLPDVM 112

  Fly    78 FAEV-KCLIEFMYKGEINVEHSSLPSLLKTADDLK----IKGLAEVTWRDDEDGPPPPMA----- 132
            ...| :.::.|.|.|.:.:....:.|.|..|..|:    :....||.     :|.|..:.     
  Rat   113 NPRVFENILLFSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCTEVL-----EGNPTVLCQKLNH 172

  Fly   133 AAEFHSPPRS----LAESY------------AQDLILQHQQQQQQGPAAPPLNLHSSAALLERDR 181
            .::..||..|    ||||:            ||:|                           ||.
  Rat   173 GSDHQSPSSSNYNGLAESFELGSGGHTDFPKAQEL---------------------------RDG 210

  Fly   182 ERERERDRERLSPGMEGVLGRMPVMTPLTGASGSAGVGSVSGGTSLEGVAPVEHFLGPKRKRGRP 246
            |.|.|..::.||                         ..|:....|...:..||           
  Rat   211 ENEEESTKDELS-------------------------SQVTEHEYLPSNSSTEH----------- 239

  Fly   247 PLDDAYDVFNVRKLAQYAANLEPAQRAYLETARHFTEEPPLAAHAASMASPPAACPPKQRQRLRH 311
                       .:|:...|:.:..:.....|..|:|.  ||       .|.|:..|   .:|..|
  Rat   240 -----------DRLSTEMASQDGEEGTNDSTEFHYTR--PL-------YSKPSIMP---HRRWIH 281

  Fly   312 QQQQQQQLLQSESSDQEQPAAGQDWSNLEPNGSATPKLLSDGDANKQETEGGDESLPAVLTTASS 376
            .:.::          .|||     |..::.:.:.....:|: ..|..:|:          .:|..
  Rat   282 VKPER----------LEQP-----WDGMDVHAAYDEHQVSE-SVNTMQTD----------HSAQP 320

  Fly   377 SGTKKLEKIGERRERHGKLRHARRLYEKSGEDEVDPPKEEPDELPQPVEEIENEHL 432
            ||.::..:|.|::.......||    |.|..|      |:.|.....:||...|.|
  Rat   321 SGAEEEFQIVEKKVEVEFDEHA----EGSNYD------EQVDFYGSSMEEFSGEKL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 28/103 (27%)
BTB 32..121 CDD:197585 27/95 (28%)
HTH_psq 587..622 CDD:283007
Zbtb43NP_001012094.1 BTB_POZ_ZBTB43 44..164 CDD:349536 32/120 (27%)
C2H2 Zn finger 412..430 CDD:275368
C2H2 Zn finger 438..458 CDD:275368
zf-H2C2_2 450..473 CDD:404364
C2H2 Zn finger 466..483 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.