DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and Zbtb37

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001100661.1 Gene:Zbtb37 / 304918 RGDID:1308731 Length:504 Species:Rattus norvegicus


Alignment Length:414 Identity:86/414 - (20%)
Similarity:143/414 - (34%) Gaps:101/414 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERDPIIIMKDVTFAEVKCLIE 86
            :||..:|..||:.:..:||..|||:|||.|.|.:|...:|........|.::|:.|..|.  |:.
  Rat    25 NQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFRDHMSLNEMSTVSISVIKNPTVFEQ--LLS 87

  Fly    87 FMYKGEINVEHSSLPSLLKTADDLKIKGLAEVTWRDDEDGPPPPMAAAEFHSPPRSLAESYAQDL 151
            |.|.|.|.::.:.:.|.|..|..|::                            :.:.:...|.|
  Rat    88 FCYTGRICLQLADIISYLTAASFLQM----------------------------QHIIDKCTQIL 124

  Fly   152 ILQHQQQQQQGPAAPPLNLHSSAALLERDRERERERDRE--RLSPGMEGVLGRMPVMTPLTGASG 214
            ...|.:          :|:....|.|.:.|.:..||..|  |::|.:...|      :|...||.
  Rat   125 EGIHFK----------INVAEVEAELSQTRTKHPERPPESHRVTPNLTRSL------SPRHNASK 173

  Fly   215 SAGVGSVSGGTSLEGVAPVEHFLGPK------RKRGRPPLDDAYDVFNVRKLAQYAANLEPAQRA 273
            ....|.||....:..::|.|....|:      ...||.|      :..:.:..|:          
  Rat   174 GNWRGQVSAVLDIRELSPPEESTSPQIIEQSSDVEGREP------ILRINRAGQW---------- 222

  Fly   274 YLETARHFTEEPPLAAHAASMASPPAACPPKQRQRLRHQQQQQQQLLQSESSDQEQPAAGQDWSN 338
            |:||.  ..::.|.:.               ...|:......:.:.|:.....:.|| :|:|.|:
  Rat   223 YVETG--IADQGPQSG---------------DEVRVLGAVHIKTENLEEWLGPENQP-SGEDGSS 269

  Fly   339 LEPNGSATPKLLSDGDANKQETEGGDESLPAVLTTASSSGTKKLEKIGERRERHGKLRHARRLYE 403
            .|...:........|..       |.||.     |..|||.|.........:|.........:.|
  Rat   270 AEEVAAMVIDTTGHGSV-------GQESY-----TLGSSGAKVARPTSSEVDRFSPSGSVVSMTE 322

  Fly   404 KSGEDEVDPPK-EEPDELPQPVEE 426
            :.......|.: :||.:|...|||
  Rat   323 RHRARSESPGRMDEPKQLSSQVEE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 30/95 (32%)
BTB 32..121 CDD:197585 26/88 (30%)
HTH_psq 587..622 CDD:283007
Zbtb37NP_001100661.1 BTB_POZ_ZBTB37 9..131 CDD:349531 33/145 (23%)
C2H2 Zn finger 377..397 CDD:275368
zf-H2C2_2 389..414 CDD:404364
zf-C2H2 403..425 CDD:395048
C2H2 Zn finger 405..425 CDD:275368
zf-H2C2_2 418..440 CDD:404364
DUF4764 <429..>497 CDD:406387
C2H2 Zn finger 433..451 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.