DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and Klhl12

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_038946329.1 Gene:Klhl12 / 266772 RGDID:628717 Length:592 Species:Rattus norvegicus


Alignment Length:227 Identity:56/227 - (24%)
Similarity:99/227 - (43%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSN-------YASER-DP 69
            |..::....:.|......|||||..|.:...|||:||.|||.:|.|:.::       |.||: .|
  Rat    32 HAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYFCAMFTSEVNASLCYLSEKGKP 96

  Fly    70 IIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAEVTWRDDEDGPPPP---- 130
            .:.::.:|.:.::.|::|:|...::|...::..||..|..|::||:.:......|....|.    
  Rat    97 YVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKGVKQACCEFLESQLDPSNCLG 161

  Fly   131 -------------MAAAEFHSPPRSLAESYAQDLILQHQQQQQQGPAAPPLNLHSSAALLE---- 178
                         |.|||..|..........::.||..|.:.::......:.:.|...:.|    
  Rat   162 IRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLIKCDEIQVDSEEPVFEAVIN 226

  Fly   179 --RDRERERERDRERLSPGMEGVLGRMPVMTP 208
              :..::|||   |.|...::.|  |||::||
  Rat   227 WVKHAKKERE---ESLPDLLQYV--RMPLLTP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 32/104 (31%)
BTB 32..121 CDD:197585 30/96 (31%)
HTH_psq 587..622 CDD:283007
Klhl12XP_038946329.1 BTB_POZ_KLHL12_C3IP1_DKIR 29..159 CDD:349551 35/126 (28%)
PHA03098 63..574 CDD:222983 48/196 (24%)
BACK_KLHL12 154..289 CDD:350527 22/105 (21%)
KELCH repeat 298..339 CDD:276965
KELCH repeat 343..389 CDD:276965
KELCH repeat 393..436 CDD:276965
KELCH repeat 440..483 CDD:276965
KELCH repeat 487..531 CDD:276965
KELCH repeat 534..579 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.