DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and pre-lola-G

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001260870.2 Gene:pre-lola-G / 14462577 FlyBaseID:FBgn0264817 Length:436 Species:Drosophila melanogaster


Alignment Length:340 Identity:64/340 - (18%)
Similarity:112/340 - (32%) Gaps:118/340 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 AANLEPAQRAYLETARHFTEEPPLAAHAASMASPPAACPPK----------QRQRLRHQQQQ--Q 316
            ||:..|..:..|:||...||.......:..:|:..||..||          .|..|.:.|||  .
  Fly   130 AASFHPRPKYTLKTAASSTEHTTAIPTSVLVANSAAALTPKPQAAVIAEALMRNGLHNFQQQLRA 194

  Fly   317 QQLLQSESSDQEQPAAGQDWSNLEPNGSATP--KLLSDGDANKQETEGGDESLPAVLTTASSSGT 379
            |::|:.:                      ||  ::..:.|.   |..|||           .:.|
  Fly   195 QEILRQQ----------------------TPHRRIKEENDV---EIAGGD-----------ITPT 223

  Fly   380 KKLEKIGERRERHGKLRHARRLYEKSGEDEVDPPKEEPDELPQPVEEIENEHLVANRAESPRPTV 444
            |.||.: .|:::...|||:        |.|.:|.....|:........::.||:..         
  Fly   224 KILENL-LRKQQERDLRHS--------ECENEPGYSTEDDEEGRYHAFDDIHLMEQ--------- 270

  Fly   445 VIPASFACKYEGGVTAAGGGSGSGTGSGSLGSSYLINEHG-----MLMAHEFAPNVASAAATAAV 504
                            :||..|:.:|.|...:    |.||     :|.||:...|:....:.   
  Fly   271 ----------------SGGKFGNNSGMGMFNA----NAHGGSASSILDAHQAFRNLEFTLSD--- 312

  Fly   505 AVAAAAAAVANASAGNGNGGQDVSGSGTGAAADYPDIKLEDYDAAELRLTNEELSQWQDVIKMDD 569
                        ..|:.:.|...|.:|.|         |:.....|.|...::. :|:..::..:
  Fly   313 ------------YGGSSSNGSTTSPNGIG---------LDGEPVYECRHCGKKY-RWKSTLRRHE 355

  Fly   570 YLAKGRRPQFWEEPF 584
            .:..|.:....:.|:
  Fly   356 NVECGGKEPSHQCPY 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045
BTB 32..121 CDD:197585
HTH_psq 587..622 CDD:283007
pre-lola-GNP_001260870.2 C2H2 Zn finger 338..358 CDD:275368 2/20 (10%)
zf-H2C2_5 366..389 CDD:290620 1/5 (20%)
C2H2 Zn finger 368..388 CDD:275368 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.