DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and AgaP_AGAP011247

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_309398.1 Gene:AgaP_AGAP011247 / 1270680 VectorBaseID:AGAP011247 Length:126 Species:Anopheles gambiae


Alignment Length:123 Identity:59/123 - (47%)
Similarity:81/123 - (65%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QQYCLRWKYHHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERD 68
            |||.|:|....:|:.|.|..|.:...|.|||||||||..:||::||.|||.:|.::|....| :.
Mosquito     5 QQYFLKWNDFQTNMVTSFRHLRNEKSFTDVTLACEGQTCKAHKMVLSACSPYFKSLLEENPS-KH 68

  Fly    69 PIIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAEVTWRDDEDG 126
            ||||:|||::..::.::||||.||:||....||:.|||||.||:|||||.......:|
Mosquito    69 PIIILKDVSYNHLQAILEFMYAGEVNVSQEQLPTFLKTADRLKVKGLAETPTNIKREG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 50/96 (52%)
BTB 32..121 CDD:197585 48/88 (55%)
HTH_psq 587..622 CDD:283007
AgaP_AGAP011247XP_309398.1 BTB_POZ_BAB-like 31..114 CDD:349624 44/83 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.