DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and lolal

DIOPT Version :10

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_061510468.1 Gene:lolal / 1270680 VectorBaseID:AGAMI1_004509 Length:126 Species:Anopheles gambiae


Alignment Length:123 Identity:59/123 - (47%)
Similarity:81/123 - (65%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QQYCLRWKYHHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERD 68
            |||.|:|....:|:.|.|..|.:...|.|||||||||..:||::||.|||.:|.::|....| :.
Mosquito     5 QQYFLKWNDFQTNMVTSFRHLRNEKSFTDVTLACEGQTCKAHKMVLSACSPYFKSLLEENPS-KH 68

  Fly    69 PIIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAEVTWRDDEDG 126
            ||||:|||::..::.::||||.||:||....||:.|||||.||:|||||.......:|
Mosquito    69 PIIILKDVSYNHLQAILEFMYAGEVNVSQEQLPTFLKTADRLKVKGLAETPTNIKREG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB_POZ_BAB-like 30..114 CDD:349624 44/83 (53%)
HTH_psq 587..622 CDD:283007
lolalXP_061510468.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.