DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3726 and gan

DIOPT Version :9

Sequence 1:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_003200482.3 Gene:gan / 100537435 ZFINID:ZDB-GENE-121221-1 Length:609 Species:Danio rerio


Alignment Length:108 Identity:24/108 - (22%)
Similarity:48/108 - (44%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERDP----IIIM 73
            |...|..:........||.|..|..||:.|...:.:|.|.|.:....| ||...::.    .|.:
Zfish    20 HSQKLLRVLQSFRQDDCFQDAVLVLEGEQIPVQKNILAAASPYIRTKL-NYNPPKEDGSVYTIEL 83

  Fly    74 KDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTAD-----DLK 111
            :.:....::.::::::.|||.:...::..:::.||     |||
Zfish    84 QGIAVTTMRQILDYIFSGEITLSEDTIQDVVQAADLLLLTDLK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3726NP_001284917.1 BTB 21..118 CDD:279045 22/100 (22%)
BTB 32..121 CDD:197585 20/89 (22%)
HTH_psq 587..622 CDD:283007
ganXP_003200482.3 BTB 46..516 CDD:333434 17/82 (21%)
KELCH repeat 325..369 CDD:276965
KELCH repeat 373..418 CDD:276965
KELCH repeat 421..466 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.