DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12236 and ttk

DIOPT Version :9

Sequence 1:NP_727050.1 Gene:CG12236 / 31523 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001189329.1 Gene:ttk / 48317 FlyBaseID:FBgn0003870 Length:813 Species:Drosophila melanogaster


Alignment Length:489 Identity:118/489 - (24%)
Similarity:201/489 - (41%) Gaps:129/489 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TQQYSLRWNNYLRHLTYSLDNHRLNDDFVDVSLCVDGRRIKAHKVVLSSCSSYFKEIFKENPHPH 68
            :|::.|||||:..:|....|.....:.|.||:|.|:|:.:||||:|||:||.||..:|..:|..|
  Fly     5 SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKH 69

  Fly    69 PVIIFKFIKFEDLNSIIEFMYQGEVNVQQEALQSFLQTAELLAVQGLTAEEKEKPQIPVAPLISE 133
            |::|.|.:.:.|:.|:::|||:|||:|.||.|.:||:.||.|.::|||....:||.         
  Fly    70 PIVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTEVNDDKPS--------- 125

  Fly   134 HKLIKTIPSTIRAVNEQQQQVSNVAQAQTATQTIEIPAATLLQATNASQVPSQVVAAAAAAAAAQ 198
                                                |||                |||.|.|...
  Fly   126 ------------------------------------PAA----------------AAAGAGATGS 138

  Fly   199 QLQVQHQQQQHHHVQTTQIQHIQVQSAPPPQQQQQQQQQQQQQQQQQQQQQQQQSQQQQTTPVQT 263
            :          ....|.|:|.||....|          |:.:.|..........:....|.|||.
  Fly   139 E----------STATTPQLQRIQPYLVP----------QRNRSQAGGLLASAANAGNTPTLPVQP 183

  Fly   264 QHLTITNAVALPAASSVKKRKITFSDDDDNMYTTETVDYAVKDEQTIVKTAEMTFLRGAVKMDIP 328
               ::.::..:|.....:.||::.|.:....      ||...|.:.::..:...   |..||...
  Fly   184 ---SLLSSALMPKRKRGRPRKLSGSSNGTGN------DYDDFDRENMMNDSSDL---GNGKMCNE 236

  Fly   329 DYI---VGEVDDRLSDGATPQTSQDATTAAAQNVAQYSSEYEILTESEMEEKYQADADNA----- 385
            .|.   .|..|::.:.|.|...::...:..::. ::.|.::.:::..|         ||:     
  Fly   237 SYSGNDDGSDDNQPNAGHTDDLNESRDSLPSKR-SKNSKDHRVVSHHE---------DNSTSVTP 291

  Fly   386 -EIAIEMT-RLLGTASGTPGAGSGQVMEDSGGGSATTGPSTTVSVTQVKSDSKASG-----TNAA 443
             :...|:: ||.|::|.|..|        :..|.::||||.|:|:.:: ||.:.|.     |...
  Fly   292 TKATPELSQRLFGSSSTTISA--------TAPGGSSTGPSETISLLEI-SDERESAPVHLPTILG 347

  Fly   444 LKPGSVTVARSSKSGATASAPPAGSDEESVQYTG 477
            ||..::.....::.|:..:  |..|..:..|.||
  Fly   348 LKIRAINTTTPAQQGSPQT--PTKSKPKIRQATG 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12236NP_727050.1 BTB 22..116 CDD:279045 42/93 (45%)
BTB 33..116 CDD:197585 40/82 (49%)
Herpes_capsid <376..467 CDD:283714 24/102 (24%)
C2H2 Zn finger 483..512 CDD:275371
C2H2 Zn finger 514..535 CDD:275371
ttkNP_001189329.1 BTB 23..119 CDD:279045 44/95 (46%)
BTB 34..119 CDD:197585 42/84 (50%)
C2H2 Zn finger 612..638 CDD:275370
zf-C2H2_4 646..669 CDD:290605
C2H2 Zn finger 648..669 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.