DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12236 and CG34376

DIOPT Version :9

Sequence 1:NP_727050.1 Gene:CG12236 / 31523 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_732741.1 Gene:CG34376 / 42638 FlyBaseID:FBgn0085405 Length:681 Species:Drosophila melanogaster


Alignment Length:531 Identity:112/531 - (21%)
Similarity:184/531 - (34%) Gaps:188/531 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QYSLRWNNYLRHLTYSLDNHRLNDDFVDVSLCVDGRRIKAHKVVLSSCSSYFKEIFKENPHPHPV 70
            ::.|.|.|:..::.....|.....|.|||:|..||:.:.|||:||:.||.||:|||..||..||:
  Fly     4 EFKLCWKNFQDNIASGFQNLYDRGDLVDVTLACDGKLLHAHKIVLAICSPYFQEIFTTNPCKHPI 68

  Fly    71 IIFKFIKFEDLNSIIEFMYQGEVNVQQEALQSFLQTAELLAVQGLTAEEKEKPQIPVAPLISEHK 135
            ||.|.:.|..:..::||||||.|||:...||||::..:||.::||                    
  Fly    69 IILKDVSFNIMMELLEFMYQGVVNVKHTELQSFMKIGQLLQIKGL-------------------- 113

  Fly   136 LIKTIPSTIRAVNEQQQQVSNVAQAQTATQTIEIPAATLLQATNASQVPSQVVAAAAAAAAAQQL 200
                      |.|......|:|::                  .::||.|::              
  Fly   114 ----------ATNSNSSPGSSVSE------------------KSSSQPPAE-------------- 136

  Fly   201 QVQHQQQQHHHVQTTQIQHIQVQSAPPPQQQQQQQQQQQQQQQQQQQQQQQQSQQQQTTP----- 260
            :..:....:||..:|                   ......:.:....:.:.||..:.|:|     
  Fly   137 ESSNTNSTNHHNSST-------------------NSNNNSKSETDHNESKGQSNSRTTSPGGASR 182

  Fly   261 --VQTQHLTITNAVALPAASSVKKRKITFSDDDDNMYTTETVDYAVKDEQTIVKTAEMTFLRGAV 323
              ....||..:|...:|:         .|..|..::|:.:.:..::||..               
  Fly   183 ASNDASHLYTSNKRPMPS---------DFGSDSLSIYSGKQLRRSLKDHG--------------- 223

  Fly   324 KMDIPDYIVGEVDDRLSDGATPQTSQDATTAAAQNVAQYSSEYEI--LTESEM-EEKY-----QA 380
                            |.|:.......|.|||..:.:..|.|:.:  :.:..| |::|     :.
  Fly   224 ----------------SGGSEGGGGDHADTAAGLDNSMNSEEFFLPPIPQITMGEQRYDLGGLKR 272

  Fly   381 DADNAEIAIEMTRLLGTASGTPGAGSGQVMEDSGG-GSATTGPSTTVSVTQV------------- 431
            ::|            |...|...||.|    :||. ||.|:..|.:..:...             
  Fly   273 ESD------------GHHHGPLSAGGG----NSGSVGSLTSSASPSAPIRNPFAPNFMDSFNYYK 321

  Fly   432 --KSDSKASGTNAALKPGSVTVARS-------------------SKSGAT-ASAPPAGSDEESVQ 474
              .|...:..:|.::.||.|....|                   |||.|. ...|.:||:...:.
  Fly   322 GGNSSGPSGSSNNSVGPGGVNNNGSVGLGSGAEYPNELYMPNDYSKSFANHMDIPSSGSNMVMLS 386

  Fly   475 YTGLAPLNCSF 485
            .|.|...||.|
  Fly   387 TTSLLHGNCVF 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12236NP_727050.1 BTB 22..116 CDD:279045 44/93 (47%)
BTB 33..116 CDD:197585 41/82 (50%)
Herpes_capsid <376..467 CDD:283714 24/131 (18%)
C2H2 Zn finger 483..512 CDD:275371 2/3 (67%)
C2H2 Zn finger 514..535 CDD:275371
CG34376NP_732741.1 BTB 20..113 CDD:279045 43/92 (47%)
BTB 31..115 CDD:197585 42/113 (37%)
FLYWCH 390..443 CDD:282369 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9606
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.