DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12236 and Aef1

DIOPT Version :9

Sequence 1:NP_727050.1 Gene:CG12236 / 31523 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster


Alignment Length:385 Identity:84/385 - (21%)
Similarity:118/385 - (30%) Gaps:153/385 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 AAAAA---------AAAAQQLQVQHQQQQHHHVQTTQIQHIQVQSAPPPQQQQQQQQQQQQQQQQ 244
            |||.|         .||..|..:.:........|.|...|:..       .|||||||||||||.
  Fly    12 AAATAMSSNCDIVIVAAQPQTTIANNNNNETVTQATHPAHMAA-------VQQQQQQQQQQQQQH 69

  Fly   245 QQQQQQQQSQQQQTTPVQTQ-------HL--------TITNAVALPAASSVKKRKITFSDDDDNM 294
            .||||||.|......|..|:       ||        :...|.|:.||.:...:..         
  Fly    70 HQQQQQQSSGPPSVPPPPTELPLPFQMHLSGISAEAHSAAQAAAMAAAQAAAAQAA--------- 125

  Fly   295 YTTETVDYAVKDEQTIVKTAEMTFLRGAVKMDIPDYIVGEVDDRLSDGATPQTSQDATTAAAQN- 358
                    |.:.:|....|:.:|.|                           |:...||..::: 
  Fly   126 --------AAEQQQPPPPTSHLTHL---------------------------TTHSPTTIHSEHY 155

  Fly   359 VAQYSSEYEILTESEMEEKYQADADNAEIAIEMTRLLGTASGTPGAGSGQVMEDSGGGSATTGP- 422
            :|...||:                                   ||.|:..|    |.|.|...| 
  Fly   156 LANGHSEH-----------------------------------PGEGNAAV----GVGGAVREPE 181

  Fly   423 ---------------STTVSVTQVKSDSKASGTNAALKP--GSVTVARSSKSGATASAPPAGSDE 470
                           ||..:..::.:..|....|...|.  .|.|:....|.             
  Fly   182 KPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKI------------- 233

  Fly   471 ESVQYTGLAPLNCSFCGRPLKSVNALRRHIASRHSEIQGKEHECFICMKSFKTKWSLSTH 530
                :||..|.||:||.:..:.::.|..|:.....|   |..||.||.|.|:...:|:.|
  Fly   234 ----HTGEKPYNCNFCPKHFRQLSTLANHVKIHTGE---KPFECVICKKQFRQSSTLNNH 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12236NP_727050.1 BTB 22..116 CDD:279045
BTB 33..116 CDD:197585
Herpes_capsid <376..467 CDD:283714 16/108 (15%)
C2H2 Zn finger 483..512 CDD:275371 7/28 (25%)
C2H2 Zn finger 514..535 CDD:275371 7/17 (41%)
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 2/19 (11%)
zf-H2C2_2 199..223 CDD:290200 3/23 (13%)
C2H2 Zn finger 214..234 CDD:275368 5/36 (14%)
zf-H2C2_2 227..251 CDD:290200 8/40 (20%)
C2H2 Zn finger 242..262 CDD:275368 5/19 (26%)
zf-H2C2_2 255..279 CDD:290200 10/26 (38%)
C2H2 Zn finger 270..290 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.