DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12236 and bab1

DIOPT Version :9

Sequence 1:NP_727050.1 Gene:CG12236 / 31523 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_728565.1 Gene:bab1 / 38116 FlyBaseID:FBgn0004870 Length:977 Species:Drosophila melanogaster


Alignment Length:309 Identity:89/309 - (28%)
Similarity:142/309 - (45%) Gaps:71/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATTQQYSLRWNNYLRHLTYSLDNHRLNDDFVDVSLCVDGRRIKAHKVVLSSCSSYFKEIFKENPH 66
            :::||:.||||||..:||...|....|:.||||:|..|||.:||||:|||:||.||:.:..|.|.
  Fly    97 SSSQQFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQTLLAETPC 161

  Fly    67 PHPVIIFKFIKFEDLNSIIEFMYQGEVNVQQEALQSFLQTAELLAVQGL---------------- 115
            .||::|.:.:.:.||.:|:||||:||:||.|:.:...|:.||:|.|:||                
  Fly   162 QHPIVIMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLRIAEMLKVRGLADVTHMEAATAAAAAA 226

  Fly   116 -----------------TAEEKEKPQIPVAPLISEHKLIKTI---PSTIRAVNEQQQQVSNVAQA 160
                             |..::|:....:...:...|.::|.   |:.:|....::||..||.:.
  Fly   227 SSERMPSSPKESTSTSRTEHDREREAEELLAFMQPEKKLRTSDWDPAELRLSPLERQQGRNVRKR 291

  Fly   161 Q-TATQTIEIPAATLLQATNASQVPSQVVAAAAAAAAAQQLQVQHQQQQHHHVQT---------- 214
            : .:..||..|.|           |...:::..||...:..|.:.::|:...:.|          
  Fly   292 RWPSADTIFNPPA-----------PPSPLSSLIAAERMELEQKERERQRDCSLMTPPPKPPMSSG 345

  Fly   215 ----------TQIQHIQVQS---APPPQQQQQQQQQQQQQQQQQQQQQQ 250
                      |.|..:.:.|   .|.|..:..:...|..||||.|||.|
  Fly   346 STVGATRRLETAIHALDMPSPAATPGPLSRSSRPHSQSPQQQQAQQQGQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12236NP_727050.1 BTB 22..116 CDD:279045 45/126 (36%)
BTB 33..116 CDD:197585 41/115 (36%)
Herpes_capsid <376..467 CDD:283714
C2H2 Zn finger 483..512 CDD:275371
C2H2 Zn finger 514..535 CDD:275371
bab1NP_728565.1 BTB 117..216 CDD:279045 45/98 (46%)
BTB 128..213 CDD:197585 41/84 (49%)
HTH_psq 569..614 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9606
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.