DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12236 and sug

DIOPT Version :9

Sequence 1:NP_727050.1 Gene:CG12236 / 31523 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster


Alignment Length:155 Identity:36/155 - (23%)
Similarity:52/155 - (33%) Gaps:49/155 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 KASGTNAALKPGSVTVARSSKSGATASAPPAGSDEESVQYTGLAPLNCSFCGRPLKSVNALRRHI 500
            ||.|....|....|.....|||.:::|.....||         ...|.:.|.|...:::||.:|:
  Fly    94 KARGQQDELCRSPVEFPDDSKSCSSSSECGTASD---------FVCNWTDCDRVFDTLDALAQHV 149

  Fly   501 ASRH-----------------------------------SEIQGKEHECFICMKSFKTKWSLSTH 530
            ..||                                   :..:.|.|.|.:|.|||....:|..|
  Fly   150 TQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHLCEKSFSRAENLKIH 214

  Fly   531 NSRFH---REMGCSTKGFTKIEYSD 552
             .|.|   :...||.:|..| .||:
  Fly   215 -IRSHSGEKPYKCSFEGCQK-AYSN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12236NP_727050.1 BTB 22..116 CDD:279045
BTB 33..116 CDD:197585
Herpes_capsid <376..467 CDD:283714 9/30 (30%)
C2H2 Zn finger 483..512 CDD:275371 8/63 (13%)
C2H2 Zn finger 514..535 CDD:275371 8/20 (40%)
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 0/19 (0%)
zf-H2C2_2 183..207 CDD:290200 7/23 (30%)
COG5048 192..>271 CDD:227381 17/48 (35%)
C2H2 Zn finger 198..218 CDD:275368 8/20 (40%)
zf-H2C2_2 210..237 CDD:290200 9/28 (32%)
C2H2 Zn finger 226..248 CDD:275368 6/13 (46%)
C2H2 Zn finger 256..277 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.